PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_22140g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 242aa    MW: 27249.8 Da    PI: 7.0643
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_22140g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd++l+++++ +G g+W++ ++  g+ R++k+c++rw +yl
    MA_22140g0010 14 KGVWTKEEDDRLIQYIQAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     799*****************************99************97 PP

2Myb_DNA-binding54.92e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++Ed+l+++++++lG++ W++Ia +++ gRt++++k++w+++l
    MA_22140g0010  67 RGSFSEDEDDLILKLHALLGNK-WSLIAGRLP-GRTDNEIKNYWNSHL 112
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.354961IPR017930Myb domain
SuperFamilySSF466891.58E-2912108IPR009057Homeodomain-like
SMARTSM007179.8E-141363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001671.44E-101761No hitNo description
PROSITE profilePS5129428.10462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2765117IPR009057Homeodomain-like
SMARTSM007178.4E-1766114IPR001005SANT/Myb domain
PfamPF002492.7E-1667112IPR001005SANT/Myb domain
CDDcd001677.43E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGRAPCCANG DRNKGVWTKE EDDRLIQYIQ AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGSF SEDEDDLILK LHALLGNKWS LIAGRLPGRT DNEIKNYWNS HLKRKLISMG  120
VDPLTHRPFQ RNSRRDLSLP GNVSEPEIAS SREIAEDFFH SPSGLCGDSE QVSDAASESL  180
ARDEPSNLNL NLELSITWPS IHAAAKEEPI LKSKPGEGDL IDEKGYLCRY EECPLGTRLL  240
LR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-30911622128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0862030.0EF086203.1 Picea sitchensis clone WS02716_N17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010431803.18e-83PREDICTED: transcription repressor MYB4-like
RefseqXP_010446371.18e-83PREDICTED: transcription repressor MYB4-like
SwissprotQ9SZP15e-83MYB4_ARATH; Transcription repressor MYB4
TrEMBLA9NXX61e-176A9NXX6_PICSI; Putative uncharacterized protein
STRINGBra033572.1-P2e-81(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.19e-83myb domain protein 4